Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIC8B Rabbit Polyclonal Antibody (HRP)

RIC8B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RIC8, hSyn

UniProt

A2RTZ0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RIC8B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060627

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZO-1 Mouse mAb, PE-Cy7 conjugated
orb2891529 100 µL

ZO-1 Mouse mAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Recombinant Human MSH6 Protein, N-His
E55P1924 50 µg

Recombinant Human MSH6 Protein, N-His

Sign In for Pricing
View Details
S-Sodium Ethanethiosulfonate
sc-471475 25 g

S-Sodium Ethanethiosulfonate

Sign In for Pricing
View Details
CDH2 (Cadherin 2, Type 1, N-Cadherin (Neuronal), CD325, CDHN, CDw325, NCAD) (MaxLight 405) discontinued
244503-ML405 100 µL

CDH2 (Cadherin 2, Type 1, N-Cadherin (Neuronal), CD325, CDHN, CDw325, NCAD) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Canine Vascular Endothelial Growth Factor A (VEGFA) ELISA Kit
DL-VEGFA-c-01 48 Tests

Canine Vascular Endothelial Growth Factor A (VEGFA) ELISA Kit

Sign In for Pricing
View Details
Canine Vascular Endothelial Growth Factor A (VEGFA) ELISA Kit
DL-VEGFA-c-02 96 Tests

Canine Vascular Endothelial Growth Factor A (VEGFA) ELISA Kit

Sign In for Pricing
View Details