Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INTS13 Rabbit Polyclonal Antibody (Biotin)

INTS13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ASUN, GCT1, NET48, Mat89Bb, SPATA30, C12orf11

UniProt

Q9NVM9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C12orf11

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDSH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060634

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey Argininosuccinate Synthetase 1 ELISA Kit
MBS049654 Inquire

Donkey Argininosuccinate Synthetase 1 ELISA Kit

Sign In for Pricing
View Details
Tumor Protein p53 (P53) Magnetic Luminex Assay Kit
LKU603772 96 Tests

Tumor Protein p53 (P53) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Human Myosin Heavy Chain 10, Non Muscle (MYH10) ELISA Kit
DL-MYH10-Hu-01 48 Tests

Human Myosin Heavy Chain 10, Non Muscle (MYH10) ELISA Kit

Sign In for Pricing
View Details
Human Myosin Heavy Chain 10, Non Muscle (MYH10) ELISA Kit
DL-MYH10-Hu-02 96 Tests

Human Myosin Heavy Chain 10, Non Muscle (MYH10) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal LRRK2 Antibody [DyLight 405]
NB110-55289V 0.1 mL

Rabbit Polyclonal LRRK2 Antibody [DyLight 405]

Sign In for Pricing
View Details
FOXQ1 (Forkhead Box Q1, HFH1) (AP)
MBS6163143-01 0.1 mL

FOXQ1 (Forkhead Box Q1, HFH1) (AP)

Sign In for Pricing
View Details