Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL8B Rabbit Polyclonal Antibody (Biotin)

ARL8B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gie1, ARL10C

UniProt

Q9NVJ2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARL8B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060654

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LCK Monoclonal Antibody
CSB-MA928082 100 µL

LCK Monoclonal Antibody

Sign In for Pricing
View Details
Human FPR2-Strep full length protein-synthetic nanodisc
MBS1883400-01 0.01 mg

Human FPR2-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human FPR2-Strep full length protein-synthetic nanodisc
MBS1883400-02 0.05 mg

Human FPR2-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human FPR2-Strep full length protein-synthetic nanodisc
MBS1883400-03 0.1 mg

Human FPR2-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Cytohesin 2, Control Peptide (ARF Exchange Factor, ARF Nucleotide-binding Site Opener, ARNO Protein, CTS18.1, Pleckstrin Homology Sec7 and Coiled-Coil Domains 2, PSCD2, Sec7p-L)
147672 100 µg

Cytohesin 2, Control Peptide (ARF Exchange Factor, ARF Nucleotide-binding Site Opener, ARNO Protein, CTS18.1, Pleckstrin Homology Sec7 and Coiled-Coil Domains 2, PSCD2, Sec7p-L)

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. indica (Rice) ETR4 Polyclonal Antibody
MBS7146221 Inquire

Rabbit anti-Oryza sativa subsp. indica (Rice) ETR4 Polyclonal Antibody

Sign In for Pricing
View Details