Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL8B Rabbit Polyclonal Antibody (HRP)

ARL8B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gie1, ARL10C

UniProt

Q9NVJ2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARL8B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060654

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TNP2 Pre-designed siRNA Set A
SI017127A 1 Each

Human TNP2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
VEGF3 (VEGFC, Vascular endothelial growth factor C, Flt4 ligand, Vascular endothelial growth factor-related protein) (MaxLight 550)
MBS6210003-01 0.1 mL

VEGF3 (VEGFC, Vascular endothelial growth factor C, Flt4 ligand, Vascular endothelial growth factor-related protein) (MaxLight 550)

Sign In for Pricing
View Details
VEGF3 (VEGFC, Vascular endothelial growth factor C, Flt4 ligand, Vascular endothelial growth factor-related protein) (MaxLight 550)
MBS6210003-02 5x 0.1 mL

VEGF3 (VEGFC, Vascular endothelial growth factor C, Flt4 ligand, Vascular endothelial growth factor-related protein) (MaxLight 550)

Sign In for Pricing
View Details
Anti-IL32 Antibody (R1S55)
RHD61302 100 μg

Anti-IL32 Antibody (R1S55)

Sign In for Pricing
View Details
Antitumor agent-75
HY-151295 1 Each

Antitumor agent-75

Sign In for Pricing
View Details
CD22 (Biotin)
C2272-88H 100 µg

CD22 (Biotin)

Sign In for Pricing
View Details