Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNMA8A Rabbit Polyclonal Antibody (HRP)

PNMA8A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PNMAL1

UniProt

Q86V59

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PNMAL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_060685

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR2A5, CT (OR2A5, OR2A26, OR2A8, Olfactory receptor 2A5, Olfactory receptor 2A26, Olfactory receptor 2A8, Olfactory receptor 7-138/7-141) (MaxLight 750)
MBS6328314-01 0.1 mL

OR2A5, CT (OR2A5, OR2A26, OR2A8, Olfactory receptor 2A5, Olfactory receptor 2A26, Olfactory receptor 2A8, Olfactory receptor 7-138/7-141) (MaxLight 750)

Sign In for Pricing
View Details
OR2A5, CT (OR2A5, OR2A26, OR2A8, Olfactory receptor 2A5, Olfactory receptor 2A26, Olfactory receptor 2A8, Olfactory receptor 7-138/7-141) (MaxLight 750)
MBS6328314-02 5x 0.1 mL

OR2A5, CT (OR2A5, OR2A26, OR2A8, Olfactory receptor 2A5, Olfactory receptor 2A26, Olfactory receptor 2A8, Olfactory receptor 7-138/7-141) (MaxLight 750)

Sign In for Pricing
View Details
MIR5591 Protein Vector (Human) (pPM-C-His)
PV099481 500 ng

MIR5591 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Anti-PNP Antibody Picoband® (monoclonal, 7G5), Cy3 Conjugate
M00988-Cy3 100 µg/Vial

Anti-PNP Antibody Picoband® (monoclonal, 7G5), Cy3 Conjugate

Sign In for Pricing
View Details
RALGDS (Ral Guanine Nucleotide Dissociation Stimulator, RalGDS, Ral Guanine Nucleotide Exchange Factor, RalGEF, KIAA1308, RGF, FLJ20922) (PE)
132288-PE 100 µL

RALGDS (Ral Guanine Nucleotide Dissociation Stimulator, RalGDS, Ral Guanine Nucleotide Exchange Factor, RalGEF, KIAA1308, RGF, FLJ20922) (PE)

Sign In for Pricing
View Details
Recombinant Thermotoga lettingae Flagellar assembly factor FliW (fliW)
MBS1012579-01 0.02 mg (E-Coli)

Recombinant Thermotoga lettingae Flagellar assembly factor FliW (fliW)

Sign In for Pricing
View Details