Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PANK4 Rabbit Polyclonal Antibody (FITC)

PANK4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DKFZp547M242, FLJ10782

UniProt

Q9NVE7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PANK4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LGAIGAFLKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRARSGTFD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

86kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060686

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLIA Kit for Monocyte Chemotactic Protein 3 (MCP3)
TRV-0052434-01 24 Tests

CLIA Kit for Monocyte Chemotactic Protein 3 (MCP3)

Sign In for Pricing
View Details
CLIA Kit for Monocyte Chemotactic Protein 3 (MCP3)
TRV-0052434-02 48 Tests

CLIA Kit for Monocyte Chemotactic Protein 3 (MCP3)

Sign In for Pricing
View Details
CLIA Kit for Monocyte Chemotactic Protein 3 (MCP3)
TRV-0052434-03 96 Tests

CLIA Kit for Monocyte Chemotactic Protein 3 (MCP3)

Sign In for Pricing
View Details
CLIA Kit for Monocyte Chemotactic Protein 3 (MCP3)
TRV-0052434-04 5x 96 Tests

CLIA Kit for Monocyte Chemotactic Protein 3 (MCP3)

Sign In for Pricing
View Details
CLIA Kit for Monocyte Chemotactic Protein 3 (MCP3)
TRV-0052434-05 10x 96 Tests

CLIA Kit for Monocyte Chemotactic Protein 3 (MCP3)

Sign In for Pricing
View Details
Lentiviral mouse Slfn2 shRNA (UAS) - Lentiviral mouse Slfn2 shRNA (UAS, iRFP) plasmid
GTR15294619 1 Vial

Lentiviral mouse Slfn2 shRNA (UAS) - Lentiviral mouse Slfn2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details