Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNPEPL1 Rabbit Polyclonal Antibody (FITC)

RNPEPL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ10806, FLJ26675, MGC99544

UniProt

Q9HAU8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RNPEPL1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_060696

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Smad3 Rabbit Polyclonal Antibody
orb2666820-01 50 µg

Phospho-Smad3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Smad3 Rabbit Polyclonal Antibody
orb2666820-02 100 µg

Phospho-Smad3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACVR1C (Activin Receptor Type-IC, Activin Receptor Type 1C, ACTR-IC, Activin Receptor-like Kinase 7, ALK-7, ALK7) (PE)
122948-PE 100 µL

ACVR1C (Activin Receptor Type-IC, Activin Receptor Type 1C, ACTR-IC, Activin Receptor-like Kinase 7, ALK-7, ALK7) (PE)

Sign In for Pricing
View Details
Monoclonal Antibody to Methionine Adenosyltransferase II Alpha (MAT2a)
TRV-0060046-01 20 µL

Monoclonal Antibody to Methionine Adenosyltransferase II Alpha (MAT2a)

Sign In for Pricing
View Details
Monoclonal Antibody to Methionine Adenosyltransferase II Alpha (MAT2a)
TRV-0060046-02 100 µL

Monoclonal Antibody to Methionine Adenosyltransferase II Alpha (MAT2a)

Sign In for Pricing
View Details
Monoclonal Antibody to Methionine Adenosyltransferase II Alpha (MAT2a)
TRV-0060046-03 200 µL

Monoclonal Antibody to Methionine Adenosyltransferase II Alpha (MAT2a)

Sign In for Pricing
View Details