Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC20 Rabbit Polyclonal Antibody (Biotin)

LRRC20 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

UNQ2429/PRO4989

UniProt

Q8TCA0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LRC20

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MLKKMGEAVARVARKVNETVESGSDTLELHLEGNFLHRLPSEVSALQHLK

Field of Research

Neuroscience

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOPBP1, ID (S1138) (TOPBP1, KIAA0259, DNA topoisomerase 2-binding protein 1, DNA topoisomerase II-beta-binding protein 1, DNA topoisomerase II-binding protein 1) (MaxLight 550)
MBS6357402-01 0.1 mL

TOPBP1, ID (S1138) (TOPBP1, KIAA0259, DNA topoisomerase 2-binding protein 1, DNA topoisomerase II-beta-binding protein 1, DNA topoisomerase II-binding protein 1) (MaxLight 550)

Sign In for Pricing
View Details
TOPBP1, ID (S1138) (TOPBP1, KIAA0259, DNA topoisomerase 2-binding protein 1, DNA topoisomerase II-beta-binding protein 1, DNA topoisomerase II-binding protein 1) (MaxLight 550)
MBS6357402-02 5x 0.1 mL

TOPBP1, ID (S1138) (TOPBP1, KIAA0259, DNA topoisomerase 2-binding protein 1, DNA topoisomerase II-beta-binding protein 1, DNA topoisomerase II-binding protein 1) (MaxLight 550)

Sign In for Pricing
View Details
Anti-MBD1 Monoclonal Antibody
M02336 100 µL/Vial

Anti-MBD1 Monoclonal Antibody

Sign In for Pricing
View Details
RPSAP35 3'UTR Luciferase Stable Cell Line
TU022344 1.0 mL

RPSAP35 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
BID siRNA (Human)
CRH0433-01 15 nmol

BID siRNA (Human)

Sign In for Pricing
View Details
BID siRNA (Human)
CRH0433-02 30 nmol

BID siRNA (Human)

Sign In for Pricing
View Details