Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC20 Rabbit Polyclonal Antibody (Biotin)

LRRC20 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

UNQ2429/PRO4989

UniProt

Q8TCA0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LRC20

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MLKKMGEAVARVARKVNETVESGSDTLELHLEGNFLHRLPSEVSALQHLK

Field of Research

Neuroscience

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEL, ID (CEL, BAL, Bile salt-activated lipase, Bile salt-stimulated lipase, Bucelipase, Carboxyl ester lipase, Cholesterol esterase, Pancreatic lysophospholipase, Sterol esterase) (Biotin)
MBS6284998-01 0.2 mL

CEL, ID (CEL, BAL, Bile salt-activated lipase, Bile salt-stimulated lipase, Bucelipase, Carboxyl ester lipase, Cholesterol esterase, Pancreatic lysophospholipase, Sterol esterase) (Biotin)

Sign In for Pricing
View Details
CEL, ID (CEL, BAL, Bile salt-activated lipase, Bile salt-stimulated lipase, Bucelipase, Carboxyl ester lipase, Cholesterol esterase, Pancreatic lysophospholipase, Sterol esterase) (Biotin)
MBS6284998-02 5x 0.2 mL

CEL, ID (CEL, BAL, Bile salt-activated lipase, Bile salt-stimulated lipase, Bucelipase, Carboxyl ester lipase, Cholesterol esterase, Pancreatic lysophospholipase, Sterol esterase) (Biotin)

Sign In for Pricing
View Details
PDE12, CT (PDE12, 2',5'-phosphodiesterase 12) (Azide free) (HRP) discontinued
039798-HRP 200 µL

PDE12, CT (PDE12, 2',5'-phosphodiesterase 12) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
ZWINT/ZW10 interactor, Human (GST)
HY-P71527 1 Each

ZWINT/ZW10 interactor, Human (GST)

Sign In for Pricing
View Details
Mortality Factor 4 like 2 (MORF4L2) Human Over-expression Lysate
orb1377434 20 µg

Mortality Factor 4 like 2 (MORF4L2) Human Over-expression Lysate

Sign In for Pricing
View Details
EFNB2 siRNA (Mouse)
MBS8228523-01 15 nmol

EFNB2 siRNA (Mouse)

Sign In for Pricing
View Details