Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wdr41 Rabbit Polyclonal Antibody (Biotin)

Wdr41 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MSTP0, MSTP048, B830029I03Rik

UniProt

Q3UDP0

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LVTPTEELPEWDIIEVKRLLDHQDNILSLANINDTGFVTGSHVGELLIWD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_766178

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diluent B (with rAlbumin)
B8533S 5 mL

Diluent B (with rAlbumin)

Sign In for Pricing
View Details
Anti-ACSBG1 Antibody, Rabbit Polyclonal
MBS8107892-01 0.1 mL

Anti-ACSBG1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-ACSBG1 Antibody, Rabbit Polyclonal
MBS8107892-02 5x 0.1 mL

Anti-ACSBG1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 12A (TNFRSF12A)
MBS2047809-01 0.1 mL

FITC-Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 12A (TNFRSF12A)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 12A (TNFRSF12A)
MBS2047809-02 0.2 mL

FITC-Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 12A (TNFRSF12A)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 12A (TNFRSF12A)
MBS2047809-03 0.5 mL

FITC-Linked Polyclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 12A (TNFRSF12A)

Sign In for Pricing
View Details