Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wdr41 Rabbit Polyclonal Antibody (FITC)

Wdr41 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MSTP0, MSTP048, B830029I03Rik

UniProt

Q3UDP0

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LVTPTEELPEWDIIEVKRLLDHQDNILSLANINDTGFVTGSHVGELLIWD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_766178

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pxn shRNA (UAS) - Lentiviral mouse Pxn shRNA (UAS, RFP) (25)
GTR15189179 1 Vial

Lentiviral mouse Pxn shRNA (UAS) - Lentiviral mouse Pxn shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
POMT1 Peptide - middle region (AAP44994)
AAP44994-100UG 100 µg

POMT1 Peptide - middle region (AAP44994)

Sign In for Pricing
View Details
CXCL5 (Chemokine (C-X-C Motif) Ligand 5, Epithelial Derived Neutrophil Activating Peptide 78, Epithelial Derived Neutrophil Activating Protein 78, ENA78, ENA-78, Neutrophil Activating Peptide ENA-78, Small Inducible Cytokine Subfamily B Member 5, Small Inducible Cytokine B5, SCYB5) (MaxLight 750) discontinued
C8297-98H-ML750 100 µL

CXCL5 (Chemokine (C-X-C Motif) Ligand 5, Epithelial Derived Neutrophil Activating Peptide 78, Epithelial Derived Neutrophil Activating Protein 78, ENA78, ENA-78, Neutrophil Activating Peptide ENA-78, Small Inducible Cytokine Subfamily B Member 5, Small Inducible Cytokine B5, SCYB5) (MaxLight 750) discontinued

Sign In for Pricing
View Details
TMEM55A Antibody
orb2680285-01 50 µL

TMEM55A Antibody

Sign In for Pricing
View Details
TMEM55A Antibody
orb2680285-02 100 µL

TMEM55A Antibody

Sign In for Pricing
View Details
TMEM55A Antibody
orb2680285-03 200 µL

TMEM55A Antibody

Sign In for Pricing
View Details