Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wdr41 Rabbit Polyclonal Antibody (FITC)

Wdr41 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MSTP0, MSTP048, B830029I03Rik

UniProt

Q3UDP0

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LVTPTEELPEWDIIEVKRLLDHQDNILSLANINDTGFVTGSHVGELLIWD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_766178

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fibroblast Growth Factor 23 (FGF23) ELISA Kit
abx254638-01 96 Tests

Mouse Fibroblast Growth Factor 23 (FGF23) ELISA Kit

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 23 (FGF23) ELISA Kit
abx254638-02 5x 96 Tests

Mouse Fibroblast Growth Factor 23 (FGF23) ELISA Kit

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 23 (FGF23) ELISA Kit
abx254638-03 10x 96 Tests

Mouse Fibroblast Growth Factor 23 (FGF23) ELISA Kit

Sign In for Pricing
View Details
MAX-40279 hydrochloride
MBS5805767 Inquire

MAX-40279 hydrochloride

Sign In for Pricing
View Details
Calcyphosine 1 Polyclonal Antibody, Cy5.5 Conjugated
bs-12161R-Cy5.5 100 µL

Calcyphosine 1 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Glut1 Polyclonal Antibody
E040967 100 µg -100 µL

Glut1 Polyclonal Antibody

Sign In for Pricing
View Details