Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS53 Rabbit Polyclonal Antibody (Biotin)

VPS53 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HCCS1, PCH2E, hVps53L, pp13624

UniProt

B3FH42

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human VPS53

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

92kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001121631

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYGB, NT (CYGB, STAP, Cytoglobin, Histoglobin, Stellate cell activation-associated protein) (MaxLight 750) discontinued
034416-ML750 100 µL

CYGB, NT (CYGB, STAP, Cytoglobin, Histoglobin, Stellate cell activation-associated protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Argonaute-2 Recombinant Rabbit mAb
ARM1407-01 30 µL

Argonaute-2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Argonaute-2 Recombinant Rabbit mAb
ARM1407-02 50 μL

Argonaute-2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Argonaute-2 Recombinant Rabbit mAb
ARM1407-03 100 µL

Argonaute-2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
RIPK3 Polyclonal Antibody
E44H09489 100 µL

RIPK3 Polyclonal Antibody

Sign In for Pricing
View Details
ELISA Kit FOR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial
E8918h 96 Tests

ELISA Kit FOR Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial

Sign In for Pricing
View Details