Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UEVLD Rabbit Polyclonal Antibody (Biotin)

UEVLD Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ATTP, UEV3

UniProt

A8MYV4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UEVLD

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060784

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX5 (NM_006940) Human Tagged ORF Clone Lentiviral Particle
RC224228L3V 200 µL

SOX5 (NM_006940) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Monoclonal Cytokeratin 17 (KRT17) (Basal Epithelial Marker) Antibody - With BSA and Azide, Clone: KRT17/778
APR14486G 0.05mg

Monoclonal Cytokeratin 17 (KRT17) (Basal Epithelial Marker) Antibody - With BSA and Azide, Clone: KRT17/778

Sign In for Pricing
View Details
Lentiviral mouse Prl2c3 shRNA (UAS) - Lentiviral mouse Prl2c3 shRNA (UAS) (100)
GTR15198954 1 Vial

Lentiviral mouse Prl2c3 shRNA (UAS) - Lentiviral mouse Prl2c3 shRNA (UAS) (100)

Sign In for Pricing
View Details
PSMD14, CT (PSMD14, POH1, 26S proteasome non-ATPase regulatory subunit 14, 26S proteasome regulatory subunit RPN11, 26S proteasome-associated PAD1 homolog 1) (Azide free) (HRP)
MBS6338264-01 0.2 mL

PSMD14, CT (PSMD14, POH1, 26S proteasome non-ATPase regulatory subunit 14, 26S proteasome regulatory subunit RPN11, 26S proteasome-associated PAD1 homolog 1) (Azide free) (HRP)

Sign In for Pricing
View Details
PSMD14, CT (PSMD14, POH1, 26S proteasome non-ATPase regulatory subunit 14, 26S proteasome regulatory subunit RPN11, 26S proteasome-associated PAD1 homolog 1) (Azide free) (HRP)
MBS6338264-02 5x 0.2 mL

PSMD14, CT (PSMD14, POH1, 26S proteasome non-ATPase regulatory subunit 14, 26S proteasome regulatory subunit RPN11, 26S proteasome-associated PAD1 homolog 1) (Azide free) (HRP)

Sign In for Pricing
View Details
Human SFTPA1 Matched Antibody Pair Set [IV11371/RD1126-Biotin]
Z01LS-1122-LS97 5 Plates

Human SFTPA1 Matched Antibody Pair Set [IV11371/RD1126-Biotin]

Sign In for Pricing
View Details