Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBC1D19 Rabbit Polyclonal Antibody (HRP)

TBC1D19 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ11082

UniProt

Q8N5T2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TBC1D19

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PVYAPKDFLEVLINLRNPNYENGDSLSFRTHLGLIQVPLKVKDIPELKEC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060787

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROR-gamma / RORC (RAR-related Orphan Receptor C) (RORC/2942), Biotin conjugate, 0.1mg/mL
BNCB2942-100 1x 100 µL

ROR-gamma / RORC (RAR-related Orphan Receptor C) (RORC/2942), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/2092R), 1mg/mL
BNUM2092-50 1x 50 µL

P53 Tumor Suppressor Protein (TP53/2092R), 1mg/mL

Sign In for Pricing
View Details
Recombinant Human EphB4/HTK Protein (aa 563-987, His & GST Tag)
PKSH030418 50 µg

Recombinant Human EphB4/HTK Protein (aa 563-987, His & GST Tag)

Sign In for Pricing
View Details
Chromogranin A (CHGA/765), Biotin conjugate, 0.1mg/mL
BNCB0765-500 1x 500 µL

Chromogranin A (CHGA/765), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3776R), Biotin conjugate, 0.1mg/mL
BNCB3776-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3776R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glycophorin A / CD235a (GYPA/280), CF740 conjugate, 0.1mg/mL
BNC740280-100 1x 100 µL

Glycophorin A / CD235a (GYPA/280), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details