Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tdp1 Rabbit Polyclonal Antibody (FITC)

Tdp1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SC, SCAN1, Gm40556, MLZ-501, AI838772, AW493413, 2810481F14Rik, 4921509N21Rik, E430034L06Rik

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ETNVYLIGSTPGRFQGSHRDNWGHFRLRKLLQAHAPSTPKGECWPIVGQF

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082630

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERp72 monoclonal antibody
orb1724219-01 50 µL

ERp72 monoclonal antibody

Sign In for Pricing
View Details
ERp72 monoclonal antibody
orb1724219-02 100 µL

ERp72 monoclonal antibody

Sign In for Pricing
View Details
TREM1 Rabbit Polyclonal Antibody (PE)
orb2578142 100 µg

TREM1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Inecalcitol
BA2861-5 5 mg

Inecalcitol

Sign In for Pricing
View Details
RAD23B, NT (RAD23B, UV excision repair protein RAD23 homolog B, XP-C repair-complementing complex 58kD protein) (Azide free) (HRP)
MBS6339980-01 0.2 mL

RAD23B, NT (RAD23B, UV excision repair protein RAD23 homolog B, XP-C repair-complementing complex 58kD protein) (Azide free) (HRP)

Sign In for Pricing
View Details
RAD23B, NT (RAD23B, UV excision repair protein RAD23 homolog B, XP-C repair-complementing complex 58kD protein) (Azide free) (HRP)
MBS6339980-02 5x 0.2 mL

RAD23B, NT (RAD23B, UV excision repair protein RAD23 homolog B, XP-C repair-complementing complex 58kD protein) (Azide free) (HRP)

Sign In for Pricing
View Details