Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tdp1 Rabbit Polyclonal Antibody (FITC)

Tdp1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SC, SCAN1, Gm40556, MLZ-501, AI838772, AW493413, 2810481F14Rik, 4921509N21Rik, E430034L06Rik

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ETNVYLIGSTPGRFQGSHRDNWGHFRLRKLLQAHAPSTPKGECWPIVGQF

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082630

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF548 (Zinc Finger Protein 548, FLJ32932)
253822 50 µL

ZNF548 (Zinc Finger Protein 548, FLJ32932)

Sign In for Pricing
View Details
Sheep Coiled-coil domain-containing protein 162 (C6orf184) ELISA Kit
MBS7205452-01 48 Well

Sheep Coiled-coil domain-containing protein 162 (C6orf184) ELISA Kit

Sign In for Pricing
View Details
Sheep Coiled-coil domain-containing protein 162 (C6orf184) ELISA Kit
MBS7205452-02 96 Well

Sheep Coiled-coil domain-containing protein 162 (C6orf184) ELISA Kit

Sign In for Pricing
View Details
Sheep Coiled-coil domain-containing protein 162 (C6orf184) ELISA Kit
MBS7205452-03 5x 96 Well

Sheep Coiled-coil domain-containing protein 162 (C6orf184) ELISA Kit

Sign In for Pricing
View Details
Sheep Coiled-coil domain-containing protein 162 (C6orf184) ELISA Kit
MBS7205452-04 10x 96 Well

Sheep Coiled-coil domain-containing protein 162 (C6orf184) ELISA Kit

Sign In for Pricing
View Details
Argininosuccinate Lyase Antibody
MBS9629139-01 0.1 mL

Argininosuccinate Lyase Antibody

Sign In for Pricing
View Details