Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tdp1 Rabbit Polyclonal Antibody (HRP)

Tdp1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SC, SCAN1, Gm40556, MLZ-501, AI838772, AW493413, 2810481F14Rik, 4921509N21Rik, E430034L06Rik

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ETNVYLIGSTPGRFQGSHRDNWGHFRLRKLLQAHAPSTPKGECWPIVGQF

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082630

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-JOE acid
204-AAT 10 mg

6-JOE acid

Sign In for Pricing
View Details
FGFR3 Rabbit Polyclonal Antibody
TA376240 100 µL

FGFR3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Twist Transcription Factor (TWIST) ELISA Kit
RD-TWIST-Hu-01 96 Tests

Human Twist Transcription Factor (TWIST) ELISA Kit

Sign In for Pricing
View Details
Human Twist Transcription Factor (TWIST) ELISA Kit
RD-TWIST-Hu-02 48 Tests

Human Twist Transcription Factor (TWIST) ELISA Kit

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (CALD1/1424R), CF647 conjugate, 0.1mg/mL
BNC471424-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (CALD1/1424R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SIL1 (NM_001037633) Human Over-expression Lysate
LC421971 20 µg

SIL1 (NM_001037633) Human Over-expression Lysate

Sign In for Pricing
View Details