Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tdp1 Rabbit Polyclonal Antibody (HRP)

Tdp1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SC, SCAN1, Gm40556, MLZ-501, AI838772, AW493413, 2810481F14Rik, 4921509N21Rik, E430034L06Rik

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ETNVYLIGSTPGRFQGSHRDNWGHFRLRKLLQAHAPSTPKGECWPIVGQF

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082630

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Decane-d22
TRC-D226345-10MG 10 mg

N-Decane-d22

Sign In for Pricing
View Details
Apc11 (ANAPC11) (NM_001002245) Human Over-expression Lysate
LY424182 100 µg

Apc11 (ANAPC11) (NM_001002245) Human Over-expression Lysate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Pan T Cells,  30nm
GM-25-30 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Pan T Cells, 30nm

Sign In for Pricing
View Details
G protein alpha S (GNAS) (NM_016592) Human Over-expression Lysate
LY402577 100 µg

G protein alpha S (GNAS) (NM_016592) Human Over-expression Lysate

Sign In for Pricing
View Details
GFAP (GA-5), CF770 conjugate, 0.1mg/mL
BNC700167-100 1x 100 µL

GFAP (GA-5), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5-Amino Isotonitazene
TRC-A433440-25MG 25 mg

5-Amino Isotonitazene

Sign In for Pricing
View Details