Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDP1 Rabbit Polyclonal Antibody (HRP)

TDP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9NUW8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of mouse TDP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GRPPGKSAVPLHLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQRWLHSY

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001008744.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRNPM Recombinant Protein (Rat)
RP204860 100 µg

HNRNPM Recombinant Protein (Rat)

Sign In for Pricing
View Details
OAS1 (2'-5'-Oligoadenylate Synthase 12'-5'-Oligoadenylate Synthetase 1, 40/46kD)
487446 100 µL

OAS1 (2'-5'-Oligoadenylate Synthase 12'-5'-Oligoadenylate Synthetase 1, 40/46kD)

Sign In for Pricing
View Details
CCDC3, CT (Coiled-coil Domain-containing Protein 3, Fat/Vessel-derived Secretory Protein, Favine) (MaxLight 650)
MBS6466136-01 0.1 mL

CCDC3, CT (Coiled-coil Domain-containing Protein 3, Fat/Vessel-derived Secretory Protein, Favine) (MaxLight 650)

Sign In for Pricing
View Details
CCDC3, CT (Coiled-coil Domain-containing Protein 3, Fat/Vessel-derived Secretory Protein, Favine) (MaxLight 650)
MBS6466136-02 5x 0.1 mL

CCDC3, CT (Coiled-coil Domain-containing Protein 3, Fat/Vessel-derived Secretory Protein, Favine) (MaxLight 650)

Sign In for Pricing
View Details
PWP2H (PWP2) Human shRNA Lentiviral Particle (Locus ID 5822)
TL310030V 500 µL Each

PWP2H (PWP2) Human shRNA Lentiviral Particle (Locus ID 5822)

Sign In for Pricing
View Details
PerCP/Cy5.5 Anti-human CD45 Antibody *HI185*
104531U1-AAT 100 Tests

PerCP/Cy5.5 Anti-human CD45 Antibody *HI185*

Sign In for Pricing
View Details