Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C4orf20 Rabbit Polyclonal Antibody (HRP)

C4orf20 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BHD, SEMDDR, C4orf20

UniProt

Q9NUQ7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C4orf20

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YHHYMQDRIDDNGWGCAYRSLQTICSWFKHQGYTERSIPTHREIQQALVD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060829

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat intercellular adhesion molecule 3 ELISA Kit
MBS724451-01 48 Well

Rat intercellular adhesion molecule 3 ELISA Kit

Sign In for Pricing
View Details
Rat intercellular adhesion molecule 3 ELISA Kit
MBS724451-02 96 Well

Rat intercellular adhesion molecule 3 ELISA Kit

Sign In for Pricing
View Details
Rat intercellular adhesion molecule 3 ELISA Kit
MBS724451-03 5x 96 Well

Rat intercellular adhesion molecule 3 ELISA Kit

Sign In for Pricing
View Details
Rat intercellular adhesion molecule 3 ELISA Kit
MBS724451-04 10x 96 Well

Rat intercellular adhesion molecule 3 ELISA Kit

Sign In for Pricing
View Details
Lentiviral human GKN2 shRNA (UAS) - Lentiviral human GKN2 shRNA (UAS, iRFP) plasmid
GTR15155488 1 Vial

Lentiviral human GKN2 shRNA (UAS) - Lentiviral human GKN2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Zebrafish CROCC2 Rabbit Polyclonal Antibody (APC)
orb3003472 100 µg

Zebrafish CROCC2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details