Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK32B Rabbit Polyclonal Antibody (FITC)

STK32B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

STK32, STKG6, YANK2, HSA250839

UniProt

Q9NY57

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human STK32B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LRYHLQQNVHFTEGTVKLYICELALALEYLQRYHIIHRDIKPDNILLDEH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_006713956

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Colony Stimulating Factor 3, Granulocyte (CSF3) ELISA Kit
abx254039 96 Well

Mouse Colony Stimulating Factor 3, Granulocyte (CSF3) ELISA Kit

Sign In for Pricing
View Details
NCK1 (Cytoplasmic Protein NCK1, Melanoma Nck Protein, MGC12668, NCK 1, Nck adaptor Protein 1, NCK alpha, NCK, NCK Tyrosine Kinase, Nck-1, NCK1, NCK1, NCKalpha, Non Catalytic region of Tyrosine Kinase, SH2/SH3 adaptor Protein NCK alpha, SH2/SH3 adaptor Protein NCK-alpha, SH2/SH3 adaptor Protein NCKalpha) discontinued
224415-01 50 µL

NCK1 (Cytoplasmic Protein NCK1, Melanoma Nck Protein, MGC12668, NCK 1, Nck adaptor Protein 1, NCK alpha, NCK, NCK Tyrosine Kinase, Nck-1, NCK1, NCK1, NCKalpha, Non Catalytic region of Tyrosine Kinase, SH2/SH3 adaptor Protein NCK alpha, SH2/SH3 adaptor Protein NCK-alpha, SH2/SH3 adaptor Protein NCKalpha) discontinued

Sign In for Pricing
View Details
NCK1 (Cytoplasmic Protein NCK1, Melanoma Nck Protein, MGC12668, NCK 1, Nck adaptor Protein 1, NCK alpha, NCK, NCK Tyrosine Kinase, Nck-1, NCK1, NCK1, NCKalpha, Non Catalytic region of Tyrosine Kinase, SH2/SH3 adaptor Protein NCK alpha, SH2/SH3 adaptor Protein NCK-alpha, SH2/SH3 adaptor Protein NCKalpha) discontinued
224415-02 100 µL

NCK1 (Cytoplasmic Protein NCK1, Melanoma Nck Protein, MGC12668, NCK 1, Nck adaptor Protein 1, NCK alpha, NCK, NCK Tyrosine Kinase, Nck-1, NCK1, NCK1, NCKalpha, Non Catalytic region of Tyrosine Kinase, SH2/SH3 adaptor Protein NCK alpha, SH2/SH3 adaptor Protein NCK-alpha, SH2/SH3 adaptor Protein NCKalpha) discontinued

Sign In for Pricing
View Details
CTNNA1 Rabbit pAb
orb2714897-01 50 µL

CTNNA1 Rabbit pAb

Sign In for Pricing
View Details
CTNNA1 Rabbit pAb
orb2714897-02 100 µL

CTNNA1 Rabbit pAb

Sign In for Pricing
View Details
CAPN10 Protein Vector (Human) (pPM-C-HA)
PV067367 500 ng

CAPN10 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details