Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK32B Rabbit Polyclonal Antibody (FITC)

STK32B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

STK32, STKG6, YANK2, HSA250839

UniProt

Q9NY57

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human STK32B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LRYHLQQNVHFTEGTVKLYICELALALEYLQRYHIIHRDIKPDNILLDEH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_006713956

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WD repeat-containing protein 70 (WDR70) Rat ELISA Kit
I2722 96 Tests

WD repeat-containing protein 70 (WDR70) Rat ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal MYLC2PL Antibody
H00093408-D01P 0.1 mg

Rabbit Polyclonal MYLC2PL Antibody

Sign In for Pricing
View Details
ALDH2 (Aldehyde Dehydrogenase 2 Family (Mitochondrial), ALDH-E2, ALDHI, ALDM, MGC1806) (AP) discontinued
243242-AP 100 µL

ALDH2 (Aldehyde Dehydrogenase 2 Family (Mitochondrial), ALDH-E2, ALDHI, ALDM, MGC1806) (AP) discontinued

Sign In for Pricing
View Details
Human DAAM1 Pre-designed siRNA Set B
SI003959B 1 Each

Human DAAM1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CENPV 3'UTR Luciferase Stable Cell Line
TU004231 1.0 mL

CENPV 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ZBTB38 Double Nickase Plasmid (h2)
sc-415181-NIC-2 20 µg

ZBTB38 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details