Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK32B Rabbit Polyclonal Antibody (HRP)

STK32B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

STK32, STKG6, YANK2, HSA250839

UniProt

Q9NY57

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human STK32B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LRYHLQQNVHFTEGTVKLYICELALALEYLQRYHIIHRDIKPDNILLDEH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_006713956

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD49b (Integrin alpha2, ITGA2, alpha-2 subunit of VLA-2 Receptor, Platelet Antigen B) (HRP) discontinued
C2404-07A-HRP 100 µL

CD49b (Integrin alpha2, ITGA2, alpha-2 subunit of VLA-2 Receptor, Platelet Antigen B) (HRP) discontinued

Sign In for Pricing
View Details
Rabbit anti-ACTN2 Antibody
MBS4512942-01 0.05 mL

Rabbit anti-ACTN2 Antibody

Sign In for Pricing
View Details
Rabbit anti-ACTN2 Antibody
MBS4512942-02 0.1 mL

Rabbit anti-ACTN2 Antibody

Sign In for Pricing
View Details
Rabbit anti-ACTN2 Antibody
MBS4512942-03 5x 0.1 mL

Rabbit anti-ACTN2 Antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 Glutathione transport system permease protein gsiC (gsiC)
orb2910365-01 20 µg

Recombinant Escherichia coli O6:K15:H31 Glutathione transport system permease protein gsiC (gsiC)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 Glutathione transport system permease protein gsiC (gsiC)
orb2910365-02 100 µg

Recombinant Escherichia coli O6:K15:H31 Glutathione transport system permease protein gsiC (gsiC)

Sign In for Pricing
View Details