Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA7 Rabbit Polyclonal Antibody (FITC)

SPATA7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HSD3, LCA3, HSD-3.1, HEL-S-296

UniProt

Q9P0W8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SPATA7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060888

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11b (Cell Surface Glycoprotein MAC1 Alpha Subunit, Complement Component Receptor 3 Alpha, CR3A, ITGAM, MAC1A, MO1A, Neutrophil Adherence Receptor) (MaxLight 405)
MBS6252358-01 0.1 mL

CD11b (Cell Surface Glycoprotein MAC1 Alpha Subunit, Complement Component Receptor 3 Alpha, CR3A, ITGAM, MAC1A, MO1A, Neutrophil Adherence Receptor) (MaxLight 405)

Sign In for Pricing
View Details
CD11b (Cell Surface Glycoprotein MAC1 Alpha Subunit, Complement Component Receptor 3 Alpha, CR3A, ITGAM, MAC1A, MO1A, Neutrophil Adherence Receptor) (MaxLight 405)
MBS6252358-02 5x 0.1 mL

CD11b (Cell Surface Glycoprotein MAC1 Alpha Subunit, Complement Component Receptor 3 Alpha, CR3A, ITGAM, MAC1A, MO1A, Neutrophil Adherence Receptor) (MaxLight 405)

Sign In for Pricing
View Details
TNFSF15 Biosimilar Antibody
orb2321745-01 50 µg

TNFSF15 Biosimilar Antibody

Sign In for Pricing
View Details
TNFSF15 Biosimilar Antibody
orb2321745-02 100 µg

TNFSF15 Biosimilar Antibody

Sign In for Pricing
View Details
PA2G4 Protein Vector (Mouse) (pPB-N-His)
PV213107 500 ng

PA2G4 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Ras-GRF1 (phosphorylated Ser916) (Ras-specific Guanine Nucleotide-Releasing Factor 1, Ras-GRF1, CDC25Mm, Guanine Nucleotide-Releasing Protein, GNRP, Ras-specific Nucleotide Exchange Factor CDC25, Rasgrf1, Cdc25, Grf1) (MaxLight 750)
MBS6458712-01 0.1 mL

Ras-GRF1 (phosphorylated Ser916) (Ras-specific Guanine Nucleotide-Releasing Factor 1, Ras-GRF1, CDC25Mm, Guanine Nucleotide-Releasing Protein, GNRP, Ras-specific Nucleotide Exchange Factor CDC25, Rasgrf1, Cdc25, Grf1) (MaxLight 750)

Sign In for Pricing
View Details