Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALLC Rabbit Polyclonal Antibody (FITC)

ALLC Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ALC

UniProt

B4DY77

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ALLC

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_060906

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Spinacia oleracea Photosystem Q (B) protein, partial
MBS7058251 Inquire

Recombinant Spinacia oleracea Photosystem Q (B) protein, partial

Sign In for Pricing
View Details
ARL13B (ADP-Ribosylation Factor-like 13B, ARL2L1, DKFZp686E2075, DKFZp686L2472, DKFZp686M2074, DKFZp761H079, JBTS8, MGC120611, MGC120612) (MaxLight 490)
MBS6205215-01 0.1 mL

ARL13B (ADP-Ribosylation Factor-like 13B, ARL2L1, DKFZp686E2075, DKFZp686L2472, DKFZp686M2074, DKFZp761H079, JBTS8, MGC120611, MGC120612) (MaxLight 490)

Sign In for Pricing
View Details
ARL13B (ADP-Ribosylation Factor-like 13B, ARL2L1, DKFZp686E2075, DKFZp686L2472, DKFZp686M2074, DKFZp761H079, JBTS8, MGC120611, MGC120612) (MaxLight 490)
MBS6205215-02 5x 0.1 mL

ARL13B (ADP-Ribosylation Factor-like 13B, ARL2L1, DKFZp686E2075, DKFZp686L2472, DKFZp686M2074, DKFZp761H079, JBTS8, MGC120611, MGC120612) (MaxLight 490)

Sign In for Pricing
View Details
DGCR6L, ID (DGCR6L, Protein DGCR6L, DiGeorge syndrome critical region 6-like protein) (MaxLight 490)
MBS6291888-01 0.1 mL

DGCR6L, ID (DGCR6L, Protein DGCR6L, DiGeorge syndrome critical region 6-like protein) (MaxLight 490)

Sign In for Pricing
View Details
DGCR6L, ID (DGCR6L, Protein DGCR6L, DiGeorge syndrome critical region 6-like protein) (MaxLight 490)
MBS6291888-02 5x 0.1 mL

DGCR6L, ID (DGCR6L, Protein DGCR6L, DiGeorge syndrome critical region 6-like protein) (MaxLight 490)

Sign In for Pricing
View Details
NAT2 Rabbit pAb, Pacific Blue conjugated
orb2890468 100 µL

NAT2 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details