Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Rat (HEK293, His)

DKK-1 Protein, with co-receptor and lipoprotein receptor binding activities, crucially regulates ossification and neuron death positively. Primarily located in the extracellular space, DKK-1 is implicated in anodontia, showing biased expression in kidney (RPKM 4.7), brain (RPKM 0.6), and two other tissues. Its role in the WNT signaling pathway and impact on visual epilepsy highlight its significance in developmental and neurological contexts. DKK-1 Protein, Rat (HEK293, His) is the recombinant rat-derived DKK-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

DKK-1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-rat-hek293-c-his.html

Purity

98.0

Smiles

TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGTDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHLPRGEIEEGIIENLGNDHGAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCATGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLACRIQKDHHQTSNSSRLHTCQRH

Molecular Formula

293897 (Gene_ID) A6I0Z0/NP_001099820.1 (T32-H270) (Accession)

Molecular Weight

Approximately 38.58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog