Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CENPN Rabbit Polyclonal Antibody (FITC)

CENPN Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BM039, CENP-N, ICEN32, C16orf60

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CENPN

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IF, WB

NCBI Accession Number

NP_001094095

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Genorise® Biotinylated Chicken PDGF polyclonal antibody
GR135030 50 µg

Genorise® Biotinylated Chicken PDGF polyclonal antibody

Sign In for Pricing
View Details
PCMV-Xcl1-LMP-1 (HBV) -HA Plasmid
PVT84615 2 µg

PCMV-Xcl1-LMP-1 (HBV) -HA Plasmid

Sign In for Pricing
View Details
Recombinant Human DNA repair protein RAD52 homolog (RAD52)
MBS960430-01 0.02 mg (E-Coli)

Recombinant Human DNA repair protein RAD52 homolog (RAD52)

Sign In for Pricing
View Details
Recombinant Human DNA repair protein RAD52 homolog (RAD52)
MBS960430-02 0.02 mg (Yeast)

Recombinant Human DNA repair protein RAD52 homolog (RAD52)

Sign In for Pricing
View Details
Recombinant Human DNA repair protein RAD52 homolog (RAD52)
MBS960430-03 0.1 mg (E-Coli)

Recombinant Human DNA repair protein RAD52 homolog (RAD52)

Sign In for Pricing
View Details
Recombinant Human DNA repair protein RAD52 homolog (RAD52)
MBS960430-04 0.1 mg (Yeast)

Recombinant Human DNA repair protein RAD52 homolog (RAD52)

Sign In for Pricing
View Details