Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM45BP Rabbit Polyclonal Antibody (FITC)

FAM45BP Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HT011, FAM45B, FAM45BP

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FAM45B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FLSKDFDARKAYPAGSIKDIVSQFGMETVILHTALMLKKRIVVYHPKIEA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060942

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STX2 Antibody
KC-19051-01 50 μL

STX2 Antibody

Sign In for Pricing
View Details
STX2 Antibody
KC-19051-02 100 µL

STX2 Antibody

Sign In for Pricing
View Details
STX2 Antibody
KC-19051-03 1 mL

STX2 Antibody

Sign In for Pricing
View Details
AKAP10 Rabbit Polyclonal Antibody
TA392720 100 µL

AKAP10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TMS1 (PYCARD) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H6]
TA800099BM 100 µL

TMS1 (PYCARD) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H6]

Sign In for Pricing
View Details
UGGT1 Rabbit Polyclonal Antibody
HA500025 100 µL

UGGT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details