Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM45BP Rabbit Polyclonal Antibody (FITC)

FAM45BP Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HT011, FAM45B, FAM45BP

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FAM45B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FLSKDFDARKAYPAGSIKDIVSQFGMETVILHTALMLKKRIVVYHPKIEA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060942

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sumo2 Mouse Gene Knockout Kit (CRISPR)
KN516981 1 Kit

Sumo2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RNF103-CHMP3 (NM_001198954) Human Recombinant Protein
TP331100 20 µg

RNF103-CHMP3 (NM_001198954) Human Recombinant Protein

Sign In for Pricing
View Details
ARSB (NM_198709) Human Recombinant Protein
TP306565M 100 µg

ARSB (NM_198709) Human Recombinant Protein

Sign In for Pricing
View Details
Antizyme inhibitor 1 (AZIN1) Mouse Monoclonal Antibody [Clone ID: OTI1D12]
CF810984 100 µg

Antizyme inhibitor 1 (AZIN1) Mouse Monoclonal Antibody [Clone ID: OTI1D12]

Sign In for Pricing
View Details
Benzaldehyde Semicarbazone
TRC-B183930-500MG 500 mg

Benzaldehyde Semicarbazone

Sign In for Pricing
View Details
TEP1 Human Gene Knockout Kit (CRISPR)
KN223614LP 1 Kit

TEP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details