Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTR10 Rabbit Polyclonal Antibody (HRP)

ACTR10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Arp10, Arp11, ACTR11, HARP11

UniProt

Q9NZ32

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ACTR10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKAL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060947

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycophorin C (GYPC) (NM_002101) Human Tagged ORF Clone Lentiviral Particle
RC210720L2V 200 µL

Glycophorin C (GYPC) (NM_002101) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
XFD750 Anti-human CD120a Antibody *H398*
112001A0-AAT 100 Tests

XFD750 Anti-human CD120a Antibody *H398*

Sign In for Pricing
View Details
PQBP1 (NM_001032381) Human Over-expression Lysate
LY422317 100 µg

PQBP1 (NM_001032381) Human Over-expression Lysate

Sign In for Pricing
View Details
AKIRIN1 (Akirin-1, C1orf108) discontinued
A1105-80D 50 µg

AKIRIN1 (Akirin-1, C1orf108) discontinued

Sign In for Pricing
View Details
Anti-RPL38 Antibody Picoband®, Carrier-free
A10156-1-carrier-free 100 µg/Vial

Anti-RPL38 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
DHFR2 Antibody - middle region : FITC (ARP53341_P050-FITC)
ARP53341_P050-FITC 100 µL

DHFR2 Antibody - middle region : FITC (ARP53341_P050-FITC)

Sign In for Pricing
View Details