Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMCO6 Rabbit Polyclonal Antibody (Biotin)

TMCO6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PRO1580

UniProt

Q96DC7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TMCO6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LRQAQRGTEEKEREGALVSLRRGLQHPETQQTFIRLEGSMRTLVGLLTSN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060972

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 Monoclonal Antibody
42018 100 µg

CD59 Monoclonal Antibody

Sign In for Pricing
View Details
RUNX2, phosphorylated (Ser465) (Runt-related Transcription Factor 2, Core-binding Factor Subunit alpha-1, CBF-alpha-1, Acute Myeloid Leukemia 3 Protein, Oncogene AML-3, Polyomavirus Enhancer-binding Protein 2 alpha A Subunit, PEBP2-alpha A, PEA2-alpha A, SL3-3 Enhancer Factor 1 alpha A Subunit, SL3/AKV Core-binding Factor alpha A Subunit, Osteoblast-specific Transcription Factor 2, OSF-2, AML3, CBFA1, OSF2, PEBP2A) (Azide free) (HRP) discontinued
R9915-10B-HRP 200 µL

RUNX2, phosphorylated (Ser465) (Runt-related Transcription Factor 2, Core-binding Factor Subunit alpha-1, CBF-alpha-1, Acute Myeloid Leukemia 3 Protein, Oncogene AML-3, Polyomavirus Enhancer-binding Protein 2 alpha A Subunit, PEBP2-alpha A, PEA2-alpha A, SL3-3 Enhancer Factor 1 alpha A Subunit, SL3/AKV Core-binding Factor alpha A Subunit, Osteoblast-specific Transcription Factor 2, OSF-2, AML3, CBFA1, OSF2, PEBP2A) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
NR5A2 Polyclonal Antibody
E55A02988 100 µg

NR5A2 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Histidine--tRNA ligase (hisS)
MBS1247770-01 0.02 mg (E-Coli)

Recombinant Acinetobacter baumannii Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Histidine--tRNA ligase (hisS)
MBS1247770-02 0.02 mg (Yeast)

Recombinant Acinetobacter baumannii Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii Histidine--tRNA ligase (hisS)
MBS1247770-03 0.1 mg (E-Coli)

Recombinant Acinetobacter baumannii Histidine--tRNA ligase (hisS)

Sign In for Pricing
View Details