Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin (swine)

Galanin (swine), a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively[1].

Product Specifications

CAS Number

[88813-36-9]

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Metabolism-protein/nucleotide metabolism

Field of Research

Metabolic Disease

Assay Protocol

https://www.medchemexpress.com/galanin-swine.html

Purity

98.99

Solubility

DMSO : 100 mg/mL (ultrasonic)

Smiles

[GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2]

Molecular Formula

C146H213N43O40

Molecular Weight

3210.52

References & Citations

[1]Branchek TA, et al. Galanin receptor subtypes. Trends Pharmacol Sci. 2000;21 (3) :109-117. |[2]Ahrén B, et al. Galanin and the endocrine pancreas. FEBS Lett. 1988;229 (2) :233-237.

Shipping Conditions

Blue Ice

Storage Conditions

-80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture and light, under nitrogen)

Scientific Category

Peptides

Clinical Information

No Development Reported

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-6R Matched ELISA Antibody Pair Set, Human
MBS8118559-01 5 Plates

IL-6R Matched ELISA Antibody Pair Set, Human

Sign In for Pricing
View Details
IL-6R Matched ELISA Antibody Pair Set, Human
MBS8118559-02 15 Plates

IL-6R Matched ELISA Antibody Pair Set, Human

Sign In for Pricing
View Details
IL-6R Matched ELISA Antibody Pair Set, Human
MBS8118559-03 5x 15 Plates

IL-6R Matched ELISA Antibody Pair Set, Human

Sign In for Pricing
View Details
MASP2 Antibody
MBS8588344-01 0.1 mg

MASP2 Antibody

Sign In for Pricing
View Details
MASP2 Antibody
MBS8588344-02 0.1 mL (AF405L)

MASP2 Antibody

Sign In for Pricing
View Details
MASP2 Antibody
MBS8588344-03 0.1 mL (AF405S)

MASP2 Antibody

Sign In for Pricing
View Details