Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin (swine)

Galanin (swine), a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively[1].

Product Specifications

CAS Number

[88813-36-9]

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Metabolism-protein/nucleotide metabolism

Field of Research

Metabolic Disease

Assay Protocol

https://www.medchemexpress.com/galanin-swine.html

Purity

98.99

Solubility

DMSO : 100 mg/mL (ultrasonic)

Smiles

[GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2]

Molecular Formula

C146H213N43O40

Molecular Weight

3210.52

References & Citations

[1]Branchek TA, et al. Galanin receptor subtypes. Trends Pharmacol Sci. 2000;21 (3) :109-117. |[2]Ahrén B, et al. Galanin and the endocrine pancreas. FEBS Lett. 1988;229 (2) :233-237.

Shipping Conditions

Blue Ice

Storage Conditions

-80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture and light, under nitrogen)

Scientific Category

Peptides

Clinical Information

No Development Reported

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCER2 Recombinant Protein (Human)
RP011980 100 µg

FCER2 Recombinant Protein (Human)

Sign In for Pricing
View Details
Rat C12h7orf50 Pre-designed siRNA Set A
SI201620A 1 Each

Rat C12h7orf50 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Vkorc1 (NM_178600) Mouse Tagged ORF Clone Lentiviral Particle
MR201263L4V 200 µL

Vkorc1 (NM_178600) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Griseofulvic Acid
012976 25 mg

Griseofulvic Acid

Sign In for Pricing
View Details
NEK6 (NM_001166168) Human Tagged ORF Clone
RG228818 10 µg

NEK6 (NM_001166168) Human Tagged ORF Clone

Sign In for Pricing
View Details
FITC Anti-Mouse Ly6G Antibody[1A8]
E-AB-F1108C-01 50 Tests

FITC Anti-Mouse Ly6G Antibody[1A8]

Sign In for Pricing
View Details