Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galanin (swine)

Galanin (swine), a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively[1].

Product Specifications

CAS Number

[88813-36-9]

UNSPSC

12352209

Target

Neuropeptide Y Receptor

Type

Peptides

Related Pathways

GPCR/G Protein; Neuronal Signaling

Applications

Metabolism-protein/nucleotide metabolism

Field of Research

Metabolic Disease

Assay Protocol

https://www.medchemexpress.com/galanin-swine.html

Purity

98.99

Solubility

DMSO : 100 mg/mL (ultrasonic)

Smiles

[GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2]

Molecular Formula

C146H213N43O40

Molecular Weight

3210.52

References & Citations

[1]Branchek TA, et al. Galanin receptor subtypes. Trends Pharmacol Sci. 2000;21 (3) :109-117. |[2]Ahrén B, et al. Galanin and the endocrine pancreas. FEBS Lett. 1988;229 (2) :233-237.

Shipping Conditions

Blue Ice

Storage Conditions

-80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture and light, under nitrogen)

Scientific Category

Peptides

Clinical Information

No Development Reported

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITCH pTyr420 Rabbit Polyclonal Antibody
AP55793PU-S 50 µL

ITCH pTyr420 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GOSR2 polyclonal antibody
BS70615-01 50 µL

GOSR2 polyclonal antibody

Sign In for Pricing
View Details
GOSR2 polyclonal antibody
BS70615-02 100 µL

GOSR2 polyclonal antibody

Sign In for Pricing
View Details
UCP1/3 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-61899R-BF750 100 µL

UCP1/3 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal N-Cadherin Antibody (CDH2/8862R) [PerCP]
NBP3-24009PCP 0.1 mL

Rabbit Monoclonal N-Cadherin Antibody (CDH2/8862R) [PerCP]

Sign In for Pricing
View Details
MAT1A Protein Vector (Rat) (pPB-C-His)
PV281266 500 ng

MAT1A Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details