Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPALPP1 Rabbit Polyclonal Antibody (Biotin)

GPALPP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LSR7, AD029, KIAA1704, bA245H20.2

UniProt

Q8IXQ4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human GPAM1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LAEQVSSYNESKRSESLMDIHHKKLKSKAAEDKNKPQERIPFDRDKDLKV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pseudomonas entomophila Probable intracellular septation protein A (PSEEN3905)
MBS7039370-01 0.02 mg

Recombinant Pseudomonas entomophila Probable intracellular septation protein A (PSEEN3905)

Sign In for Pricing
View Details
Recombinant Pseudomonas entomophila Probable intracellular septation protein A (PSEEN3905)
MBS7039370-02 0.1 mg

Recombinant Pseudomonas entomophila Probable intracellular septation protein A (PSEEN3905)

Sign In for Pricing
View Details
Recombinant Pseudomonas entomophila Probable intracellular septation protein A (PSEEN3905)
MBS7039370-03 5x 0.1 mg

Recombinant Pseudomonas entomophila Probable intracellular septation protein A (PSEEN3905)

Sign In for Pricing
View Details
Trim65 Mouse shRNA Lentiviral Particle (Locus ID 338364)
TL508515V 500 µL Each

Trim65 Mouse shRNA Lentiviral Particle (Locus ID 338364)

Sign In for Pricing
View Details
Influenza A Nucleoprotein (NP) (AP)
MBS6126291-01 0.1 mL

Influenza A Nucleoprotein (NP) (AP)

Sign In for Pricing
View Details
Influenza A Nucleoprotein (NP) (AP)
MBS6126291-02 5x 0.1 mL

Influenza A Nucleoprotein (NP) (AP)

Sign In for Pricing
View Details