Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPALPP1 Rabbit Polyclonal Antibody (FITC)

GPALPP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LSR7, AD029, KIAA1704, bA245H20.2

UniProt

Q8IXQ4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human GPAM1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LAEQVSSYNESKRSESLMDIHHKKLKSKAAEDKNKPQERIPFDRDKDLKV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3BP4 (NM_014521) Human Tagged ORF Clone
RG208730 10 µg

SH3BP4 (NM_014521) Human Tagged ORF Clone

Sign In for Pricing
View Details
RHAG sgRNA CRISPR Lentivector set (Human)
K1819001 3x 1.0 µg

RHAG sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
ZFAND3 Mouse Monoclonal Antibody [Clone ID: LBI1G5]
AMM14264VCF 100 µg

ZFAND3 Mouse Monoclonal Antibody [Clone ID: LBI1G5]

Sign In for Pricing
View Details
Lipin 3 Polyclonal Antibody
MBS9236594-01 0.1 mL

Lipin 3 Polyclonal Antibody

Sign In for Pricing
View Details
Lipin 3 Polyclonal Antibody
MBS9236594-02 5x 0.1 mL

Lipin 3 Polyclonal Antibody

Sign In for Pricing
View Details
MYBL1 Antibody - middle region : HRP (ARP40093_P050-HRP)
ARP40093_P050-HRP 100 µL

MYBL1 Antibody - middle region : HRP (ARP40093_P050-HRP)

Sign In for Pricing
View Details