Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnaja4 Rabbit Polyclonal Antibody (HRP)

Dnaja4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q4QR73

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Dnaja4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IIEVHVDKGMKDGQKILFHGEGDQEPELEPGDVIIVLDQKDHSVFQRRGH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001020582

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLRG1 shRNA (h) Lentiviral Particles
sc-76170-V 200 µL

PLRG1 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Lentiviral human PIKFYVE sgRNA gene knockout kit - Lentiviral human PIKFYVE sgRNA gene knockout kit (plasmid)
GTR15395093 1 Vial

Lentiviral human PIKFYVE sgRNA gene knockout kit - Lentiviral human PIKFYVE sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Recombinant Anti-HLA-A2-peptide (YLEPGPVT) Complex (2F1)
MBS1568442-01 0.1 mg

Recombinant Anti-HLA-A2-peptide (YLEPGPVT) Complex (2F1)

Sign In for Pricing
View Details
Recombinant Anti-HLA-A2-peptide (YLEPGPVT) Complex (2F1)
MBS1568442-02 1 mg

Recombinant Anti-HLA-A2-peptide (YLEPGPVT) Complex (2F1)

Sign In for Pricing
View Details
Recombinant Anti-HLA-A2-peptide (YLEPGPVT) Complex (2F1)
MBS1568442-03 5x 1 mg

Recombinant Anti-HLA-A2-peptide (YLEPGPVT) Complex (2F1)

Sign In for Pricing
View Details
ARIH2, CT (ARIH2, ARI2, TRIAD1, E3 ubiquitin-protein ligase ARIH2, Triad1 protein) (PE)
MBS6275082-01 0.2 mL

ARIH2, CT (ARIH2, ARI2, TRIAD1, E3 ubiquitin-protein ligase ARIH2, Triad1 protein) (PE)

Sign In for Pricing
View Details