Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJA4 Rabbit Polyclonal Antibody (Biotin)

DNAJA4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MST104, MSTP104, PRO1472

UniProt

Q8WW22

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human DNAJA4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EKGILIIQFLVIFPEKHWLSLEKLPQLEALLPPRQKVRITDDMDQVELKE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001123654.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-PDGFC Antibody
MBS4507286-01 0.05 mL

Rabbit anti-PDGFC Antibody

Sign In for Pricing
View Details
Rabbit anti-PDGFC Antibody
MBS4507286-02 0.1 mL

Rabbit anti-PDGFC Antibody

Sign In for Pricing
View Details
Rabbit anti-PDGFC Antibody
MBS4507286-03 5x 0.1 mL

Rabbit anti-PDGFC Antibody

Sign In for Pricing
View Details
Diisopropyl Trofinetide
CS-O-58682 1 Each

Diisopropyl Trofinetide

Sign In for Pricing
View Details
FARP1 (FERM, RhoGEF and Pleckstrin Domain-containing Protein 1, Chondrocyte-derived Ezrin-like Protein, Pleckstrin Homology Domain-containing Family C Member 2, PH Domain-containing Family C Member 2, CDEP, PLEKHC2) (APC)
126627-APC 100 µL

FARP1 (FERM, RhoGEF and Pleckstrin Domain-containing Protein 1, Chondrocyte-derived Ezrin-like Protein, Pleckstrin Homology Domain-containing Family C Member 2, PH Domain-containing Family C Member 2, CDEP, PLEKHC2) (APC)

Sign In for Pricing
View Details
KIF3B Rabbit Polyclonal Antibody
orb574875 100 µL

KIF3B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details