Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELMOD1 Rabbit Polyclonal Antibody (Biotin)

ELMOD1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8N336

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ELMOD1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061182

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IgG F (ab') 2 Antibody - Rhodamine Conjugated
OARA05134-1MG 1 mg

Mouse IgG F (ab') 2 Antibody - Rhodamine Conjugated

Sign In for Pricing
View Details
HIPK1 (Homeodomain Interacting Protein Kinase 1, KIAA0630, MGC26642, MGC33446, MGC33548, Myak, Nbak2) (MaxLight 405)
MBS6195973-01 0.1 mL

HIPK1 (Homeodomain Interacting Protein Kinase 1, KIAA0630, MGC26642, MGC33446, MGC33548, Myak, Nbak2) (MaxLight 405)

Sign In for Pricing
View Details
HIPK1 (Homeodomain Interacting Protein Kinase 1, KIAA0630, MGC26642, MGC33446, MGC33548, Myak, Nbak2) (MaxLight 405)
MBS6195973-02 5x 0.1 mL

HIPK1 (Homeodomain Interacting Protein Kinase 1, KIAA0630, MGC26642, MGC33446, MGC33548, Myak, Nbak2) (MaxLight 405)

Sign In for Pricing
View Details
Fuk sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3130504 1.0 µg DNA

Fuk sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
ATF4 (Activating Transcription Factor 4, CREB-2, CREB2, TAXREB67, TXREB) (APC)
MBS6407478-01 0.1 mL

ATF4 (Activating Transcription Factor 4, CREB-2, CREB2, TAXREB67, TXREB) (APC)

Sign In for Pricing
View Details
ATF4 (Activating Transcription Factor 4, CREB-2, CREB2, TAXREB67, TXREB) (APC)
MBS6407478-02 5x 0.1 mL

ATF4 (Activating Transcription Factor 4, CREB-2, CREB2, TAXREB67, TXREB) (APC)

Sign In for Pricing
View Details