Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rcc2 Rabbit Polyclonal Antibody (Biotin)

Rcc2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Td60, AA536646, AA675016, mKIAA1470, 2610510H01Rik, 2610529N02Rik

UniProt

Q8BK67

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GATNWDLIGRKEVPKQQAAYRNLGQNLWGPHRYGCLSGVRVRTVVSGSCA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_776292

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzethonium hydroxide solution
sc-280610B 500 mL

Benzethonium hydroxide solution

Sign In for Pricing
View Details
RGCC (C13orf15, RGC32, Regulator of Cell Cycle RGCC, Response Gene to Complement 32 Protein) (Biotin)
MBS6144007-01 0.1 mL

RGCC (C13orf15, RGC32, Regulator of Cell Cycle RGCC, Response Gene to Complement 32 Protein) (Biotin)

Sign In for Pricing
View Details
RGCC (C13orf15, RGC32, Regulator of Cell Cycle RGCC, Response Gene to Complement 32 Protein) (Biotin)
MBS6144007-02 5x 0.1 mL

RGCC (C13orf15, RGC32, Regulator of Cell Cycle RGCC, Response Gene to Complement 32 Protein) (Biotin)

Sign In for Pricing
View Details
Microcentrifuge Tubes
CS0027 1 Each

Microcentrifuge Tubes

Sign In for Pricing
View Details
Sheep Laminin Beta 2 ELISA Kit
MBS047790-01 48 Well

Sheep Laminin Beta 2 ELISA Kit

Sign In for Pricing
View Details
Sheep Laminin Beta 2 ELISA Kit
MBS047790-02 96 Well

Sheep Laminin Beta 2 ELISA Kit

Sign In for Pricing
View Details