Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rcc2 Rabbit Polyclonal Antibody (HRP)

Rcc2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Td60, AA536646, AA675016, mKIAA1470, 2610510H01Rik, 2610529N02Rik

UniProt

Q8BK67

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GATNWDLIGRKEVPKQQAAYRNLGQNLWGPHRYGCLSGVRVRTVVSGSCA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_776292

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDRG2 (NM_201541) Human Tagged Lenti ORF Clone
RC210598L3 10 µg

NDRG2 (NM_201541) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Dhx8 Rat siRNA Oligo Duplex (Locus ID 287727)
SR511494 1 Kit

Dhx8 Rat siRNA Oligo Duplex (Locus ID 287727)

Sign In for Pricing
View Details
GATA6 monoclonal antibody
MB66495-01 50 µL

GATA6 monoclonal antibody

Sign In for Pricing
View Details
GATA6 monoclonal antibody
MB66495-02 100 µL

GATA6 monoclonal antibody

Sign In for Pricing
View Details
RPL36AP34 Adenovirus (Human)
41561051 1.0 mL

RPL36AP34 Adenovirus (Human)

Sign In for Pricing
View Details
HEK293/Human TSPAN8 Stable Cell Line
CSB-SC025166HU3-E 1 Vial - 5x 10^6 Cells in 1 mL

HEK293/Human TSPAN8 Stable Cell Line

Sign In for Pricing
View Details