Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sntg1 Rabbit Polyclonal Antibody (FITC)

Sntg1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SY, G1S, SYN4, G1SYN, 4933426D16Rik

UniProt

Q925E1

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KLPVNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPG

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_081947

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gckr sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6869307 1.0 µg DNA

Gckr sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Monkey PreHbA Matched Antibody Pair Set [ABP-S-04890]
ABP-S-04890 5 Plates

Monkey PreHbA Matched Antibody Pair Set [ABP-S-04890]

Sign In for Pricing
View Details
HTLV-2 p24 (75/4.21.11)
sc-57876 100 µg/mL

HTLV-2 p24 (75/4.21.11)

Sign In for Pricing
View Details
PRDM14 AAV siRNA Pooled Vector
37571161 1.0 µg

PRDM14 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Porcine Runt Related Transcription Factor 2 ELISA kit
GTR10418579 96 Well

Porcine Runt Related Transcription Factor 2 ELISA kit

Sign In for Pricing
View Details
C9orf93 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-15348R-BF488 100 µL

C9orf93 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details