Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sntg1 Rabbit Polyclonal Antibody (HRP)

Sntg1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SY, G1S, SYN4, G1SYN, 4933426D16Rik

UniProt

Q925E1

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KLPVNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPG

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_081947

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GJA1 (N-term) Rabbit Polyclonal Antibody
AP11568PU-N 400 µL

GJA1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS503499 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Cytokeratin 8 (K8.8), CF740 conjugate, 0.1mg/mL
BNC740689-500 1x 500 µL

Cytokeratin 8 (K8.8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human CD112/Nectin-2 Protein
PKSH031939 100 µg

Recombinant Human CD112/Nectin-2 Protein

Sign In for Pricing
View Details
ATG5 (Autophagy Marker) (ATG5/2101), CF647 conjugate, 0.1mg/mL
BNC472101-100 1x 100 µL

ATG5 (Autophagy Marker) (ATG5/2101), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Genomic DNA, Skin
CD564677 5 µg

Tissue Genomic DNA, Skin

Sign In for Pricing
View Details