Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNTG1 Rabbit Polyclonal Antibody (Biotin)

SNTG1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SYN4, G1SYN

UniProt

Q9NSN8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SNTG1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_061840

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCRTR1, ID (HCRTR1, Orexin receptor type 1, Hypocretin receptor type 1) (MaxLight 650)
MBS6305831-01 0.1 mL

HCRTR1, ID (HCRTR1, Orexin receptor type 1, Hypocretin receptor type 1) (MaxLight 650)

Sign In for Pricing
View Details
HCRTR1, ID (HCRTR1, Orexin receptor type 1, Hypocretin receptor type 1) (MaxLight 650)
MBS6305831-02 5x 0.1 mL

HCRTR1, ID (HCRTR1, Orexin receptor type 1, Hypocretin receptor type 1) (MaxLight 650)

Sign In for Pricing
View Details
Bismuth (Bi) 10000 ppm Single Element Std. Soln. for ICP in HNO3 Nist Traceable
809952-01 100 mL

Bismuth (Bi) 10000 ppm Single Element Std. Soln. for ICP in HNO3 Nist Traceable

Sign In for Pricing
View Details
Bismuth (Bi) 10000 ppm Single Element Std. Soln. for ICP in HNO3 Nist Traceable
809952-02 500 mL

Bismuth (Bi) 10000 ppm Single Element Std. Soln. for ICP in HNO3 Nist Traceable

Sign In for Pricing
View Details
Anti-eIF4A2 Rabbit pAb
GB113715-50 50 μL

Anti-eIF4A2 Rabbit pAb

Sign In for Pricing
View Details
Human GGCT (Gamma-Glutamylcyclotransferase) ELISA Kit
orb3127181-01 48 Tests

Human GGCT (Gamma-Glutamylcyclotransferase) ELISA Kit

Sign In for Pricing
View Details