Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TERF2IP Rabbit Polyclonal Antibody (Biotin)

TERF2IP Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RAP1, DRIP5

UniProt

Q9NYB0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TERF2IP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_061848

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JMJD2B (T305) (KDM4B, JHDM3B, JMJD2B, KIAA0876, Lysine-specific demethylase 4B, JmjC domain-containing histone demethylation protein 3B, Jumonji domain-containing protein 2B) (MaxLight 550) discontinued
037197-ML550 100 µL

JMJD2B (T305) (KDM4B, JHDM3B, JMJD2B, KIAA0876, Lysine-specific demethylase 4B, JmjC domain-containing histone demethylation protein 3B, Jumonji domain-containing protein 2B) (MaxLight 550) discontinued

Sign In for Pricing
View Details
P4HA3 Protein Vector (Human) (pPM-C-His)
PV056000 500 ng

P4HA3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Lentiviral human LARGE2 shRNA (UAS) - Lentiviral human LARGE2 shRNA (UAS) (25)
GTR15094457 1 Vial

Lentiviral human LARGE2 shRNA (UAS) - Lentiviral human LARGE2 shRNA (UAS) (25)

Sign In for Pricing
View Details
PLET1 Rabbit Polyclonal Antibody (PE)
orb2588089 100 µg

PLET1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
KCNIP2 (Kv Channel-interacting Protein 2, KChIP2, A-type Potassium Channel Modulatory Protein 2, Cardiac Voltage-gated Potassium Channel Modulatory Subunit, Potassium Channel-interacting Protein 2, DKFZp566L1246, MGC17241) (AP) discontinued
128744-AP 100 µL

KCNIP2 (Kv Channel-interacting Protein 2, KChIP2, A-type Potassium Channel Modulatory Protein 2, Cardiac Voltage-gated Potassium Channel Modulatory Subunit, Potassium Channel-interacting Protein 2, DKFZp566L1246, MGC17241) (AP) discontinued

Sign In for Pricing
View Details
ETBR2 Antibody
MBS9606378-01 0.1 mL

ETBR2 Antibody

Sign In for Pricing
View Details