Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXorf9 Rabbit Polyclonal Antibody (FITC)

CXorf9 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SLY, 753P9, HACS2, CXorf9, SH3D6C

UniProt

Q8K352

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CXorf9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061863

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granzyme A Recombinant Rabbit monoclonal Antibody
HA751521 100 µL

Granzyme A Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
PSMD2 Rabbit Polyclonal Antibody
HA500353 100 µL

PSMD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RAP1A (C-term) Rabbit Polyclonal Antibody
AP53578PU-N 400 µL

RAP1A (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SCARA5 Human Gene Knockout Kit (CRISPR)
KN419554 1 Kit

SCARA5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PRPK (TP53RK) Human Gene Knockout Kit (CRISPR)
KN209748BN 1 Kit

PRPK (TP53RK) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/2480), CF594 conjugate, 0.1mg/mL
BNC943607-100 1x 100 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/2480), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details