Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXorf9 Rabbit Polyclonal Antibody (HRP)

CXorf9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SLY, 753P9, HACS2, CXorf9, SH3D6C

UniProt

O75995

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CXorf9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRET

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061863

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF540 Lentiviral Activation Particles (h2)
sc-414860-LAC-2 200 µL

ZNF540 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
SCNN1B Antibody, HRP conjugated
MBS7105882-01 0.05 mg

SCNN1B Antibody, HRP conjugated

Sign In for Pricing
View Details
SCNN1B Antibody, HRP conjugated
MBS7105882-02 0.1 mg

SCNN1B Antibody, HRP conjugated

Sign In for Pricing
View Details
SCNN1B Antibody, HRP conjugated
MBS7105882-03 5x 0.1 mg

SCNN1B Antibody, HRP conjugated

Sign In for Pricing
View Details
Suppressor Of Cytokine Signaling 3 (SOCS-3) (193-225) / CIS-3 (193-225) (Human, Rat, Mouse)
035-78 100 µg

Suppressor Of Cytokine Signaling 3 (SOCS-3) (193-225) / CIS-3 (193-225) (Human, Rat, Mouse)

Sign In for Pricing
View Details
RPS20 polyclonal antibody
BS74470-01 50 µL

RPS20 polyclonal antibody

Sign In for Pricing
View Details