Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apbb1ip Rabbit Polyclonal Antibody (Biotin)

Apbb1ip Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Apbb1ip

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PPREEFNFSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001094047

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Stomach
CS807480 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
SUB1 (SUB1 Homolog (S. cerevisiae), MGC102747, P15, PC4, p14) (MaxLight 490)
MBS6208800-01 0.1 mL

SUB1 (SUB1 Homolog (S. cerevisiae), MGC102747, P15, PC4, p14) (MaxLight 490)

Sign In for Pricing
View Details
SUB1 (SUB1 Homolog (S. cerevisiae), MGC102747, P15, PC4, p14) (MaxLight 490)
MBS6208800-02 5x 0.1 mL

SUB1 (SUB1 Homolog (S. cerevisiae), MGC102747, P15, PC4, p14) (MaxLight 490)

Sign In for Pricing
View Details
(2S) -1-Fluorobutan-2-amine, hydrochloride
GFD28710-01 50 mg

(2S) -1-Fluorobutan-2-amine, hydrochloride

Sign In for Pricing
View Details
(2S) -1-Fluorobutan-2-amine, hydrochloride
GFD28710-02 0.5 g

(2S) -1-Fluorobutan-2-amine, hydrochloride

Sign In for Pricing
View Details
Pop4 Rat shRNA Lentiviral Particle (Locus ID 292831)
TL701293V 500 µL Each

Pop4 Rat shRNA Lentiviral Particle (Locus ID 292831)

Sign In for Pricing
View Details