Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC6 Rabbit Polyclonal Antibody (FITC)

EXOC6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SEC15, EXOC6A, SEC15L, Sec15p, SEC15L1, SEC15L3

UniProt

B3KXY5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EXOC6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

88kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001013870

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Solute Carrier Family 23 Member 1 (SLC23A1) ELISA Kit
MBS9927990-01 48 Well

Monkey Solute Carrier Family 23 Member 1 (SLC23A1) ELISA Kit

Sign In for Pricing
View Details
Monkey Solute Carrier Family 23 Member 1 (SLC23A1) ELISA Kit
MBS9927990-02 96 Well

Monkey Solute Carrier Family 23 Member 1 (SLC23A1) ELISA Kit

Sign In for Pricing
View Details
Monkey Solute Carrier Family 23 Member 1 (SLC23A1) ELISA Kit
MBS9927990-03 5x 96 Well

Monkey Solute Carrier Family 23 Member 1 (SLC23A1) ELISA Kit

Sign In for Pricing
View Details
Monkey Solute Carrier Family 23 Member 1 (SLC23A1) ELISA Kit
MBS9927990-04 10x 96 Well

Monkey Solute Carrier Family 23 Member 1 (SLC23A1) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human FOXD2 shRNA (UAS) - Lentiviral human FOXD2 shRNA (UAS, RFP) (25)
GTR15080903 1 Vial

Lentiviral human FOXD2 shRNA (UAS) - Lentiviral human FOXD2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
C130021O09Rik 3'UTR Luciferase Stable Cell Line
TU102919 1.0 mL

C130021O09Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details