Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC6 Rabbit Polyclonal Antibody (HRP)

EXOC6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SEC15, EXOC6A, SEC15L, Sec15p, SEC15L1, SEC15L3

UniProt

B3KXY5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EXOC6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

88kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001013870

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ALG1 sgRNA gene knockout kit - Lentiviral human ALG1 sgRNA gene knockout kit (25)
GTR15356691 1 Vial

Lentiviral human ALG1 sgRNA gene knockout kit - Lentiviral human ALG1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
CHN2 Protein (N-His, Human)
P502548 100 µg

CHN2 Protein (N-His, Human)

Sign In for Pricing
View Details
Lentiviral mouse Inip shRNA (UAS) - Lentiviral mouse Inip shRNA (UAS, iRFP) plasmid
GTR15265492 1 Vial

Lentiviral mouse Inip shRNA (UAS) - Lentiviral mouse Inip shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Mouse Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit
MBS7222068-01 48 Well

Mouse Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit

Sign In for Pricing
View Details
Mouse Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit
MBS7222068-02 96 Well

Mouse Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit

Sign In for Pricing
View Details
Mouse Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit
MBS7222068-03 5x 96 Well

Mouse Coiled-coil domain-containing protein 104 (CCDC104) ELISA Kit

Sign In for Pricing
View Details