Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC76 Rabbit Polyclonal Antibody (HRP)

CCDC76 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CCDC76

UniProt

Q9NUP7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC76

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061956

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP8 Antibody
orb3159956-01 50 µL

CASP8 Antibody

Sign In for Pricing
View Details
CASP8 Antibody
orb3159956-02 100 µL

CASP8 Antibody

Sign In for Pricing
View Details
Opn1sw2 Antibody
orb860728 2 mg

Opn1sw2 Antibody

Sign In for Pricing
View Details
Monkey UGT2B4 (Uridine Dipho-sphate Glucuronosyltransferase 2 Family Polypeptide B4) ELISA Kit
MBS2507706-01 24 Tests

Monkey UGT2B4 (Uridine Dipho-sphate Glucuronosyltransferase 2 Family Polypeptide B4) ELISA Kit

Sign In for Pricing
View Details
Monkey UGT2B4 (Uridine Dipho-sphate Glucuronosyltransferase 2 Family Polypeptide B4) ELISA Kit
MBS2507706-02 48 Tests

Monkey UGT2B4 (Uridine Dipho-sphate Glucuronosyltransferase 2 Family Polypeptide B4) ELISA Kit

Sign In for Pricing
View Details
Monkey UGT2B4 (Uridine Dipho-sphate Glucuronosyltransferase 2 Family Polypeptide B4) ELISA Kit
MBS2507706-03 96 Tests

Monkey UGT2B4 (Uridine Dipho-sphate Glucuronosyltransferase 2 Family Polypeptide B4) ELISA Kit

Sign In for Pricing
View Details